Protein Labeling Reagents
Biotium c-Myb(MYB286), CF488A conjugate, 0.1mg/mL
The highly leukemogenic avian retrovirus E26 contains two oncogenes, v-Myb and v-Ets, which are expressed together as a fusion protein. The cellular homolog of v-Myb, designated c-Myb, encodes a transcription factor. Deletion or disruption of a negative regulatory domain mapping within the carboxy-terminal domain of c-Myb results in enhanced transactivating capacity and in parallel, leads to activation of its ability to transform hemopoietic cells. c-Myb is expressed preferentially, but not exclusively, in immature hemopoietic cells and its expression decreases as cells differentiate.Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF405S and CF405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.
Lumiprobe BDP 650/665 X NHS ester | 235439-04-0 | MFCD30182302 | 5 mg
BDP 650/665 X NHS ester | Purity: 95% | Mol Wt: 643.45 | 235439-04-0 | MFCD30182302 | 5 mg
![eMolecules 252255-42-8 | Sulfo-Cy5 bis-NHS ester | Broadpharm975.140 | C45H51KN4O14S2 | 0.000 | [K+].CC1(C)\C(=C/C=C/C=C/C2=[N+](CCCCCC(=O)ON3C(=O)CCC3=O)c3ccc(cc3C2(C)C)S([O-])(=O)=O)N(CCCCCC(=O)ON2C(=O)CCC2=O)c2ccc(cc12)S([O-])(=O)=O | 1mg | 761705599](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502461537.JPG-250.jpg)
eMolecules 252255-42-8 | Sulfo-Cy5 bis-NHS ester | Broadpharm975.140 | C45H51KN4O14S2 | 0.000 | [K+].CC1(C)\C(=C/C=C/C=C/C2=[N+](CCCCCC(=O)ON3C(=O)CCC3=O)c3ccc(cc3C2(C)C)S([O-])(=O)=O)N(CCCCCC(=O)ON2C(=O)CCC2=O)c2ccc(cc12)S([O-])(=O)=O | 1mg | 761705599
Sulfo-Cy5 bis-NHS ester | Broadpharm | 252255-42-8975.140 | C45H51KN4O14S2 | 0.000 | [K+].CC1(C)\C(=C/C=C/C=C/C2=[N+](CCCCCC(=O)ON3C(=O)CCC3=O)c3ccc(cc3C2(C)C)S([O-])(=O)=O)N(CCCCCC(=O)ON2C(=O)CCC2=O)c2ccc(cc12)S([O-])(=O)=O | 1mg | 761705599
Dojindo Molecular Technologies Inc PlasMem Bright Green dye (100 ul) offers plasma membrane staining for 24 hrs+ with clear visualization, high retentivity, low toxicity, water-soluble, no washing, applicable to live and fixed cells.
The plasma membrane consists of a lipid bilayer separating the intracellular environment from the extracellular space. Thus, the PM plays a central role in many cell behaviors such as cell migration, cell stretching, and signaling cascades. Additionally, PM dysfunction is an important biomarker because it is related to cell status and is linked to many diseases. PlasMem Bright dyes have higher retentivity on the plasma membrane. Furthermore, PlasMem Bright dyes are more water-soluble compared with other commercially available dyes and can be diluted with the culture medium. The PlasMem Bright dyes offer two different color options (green and red) and provide ready-to-use DMSO solutions. A working solution can be prepared easily via a single dilution step using growth medium or HBSS. Dojindo offers various reagents for cell membrane research. (https://www.dojindo.com/track-the-dynamics-of-plasma-membrane/)
![eMolecules Broadpharm / BP Fluor 568 Cadaverine / 1mg / 599128672 / BP-25569 / / / [null] / 778.890 / C38H42N4O10S2](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502471225.JPG-250.jpg)
eMolecules Broadpharm / BP Fluor 568 Cadaverine / 1mg / 599128672 / BP-25569 / / / [null] / 778.890 / C38H42N4O10S2
Broadpharm / BP Fluor 568 Cadaverine / 1mg / 599128672 / BP-25569 / / / [null] / 778.890 / C38H42N4O10S2
Medchemexpress LLC HY-D0719 5g Medchemexpress, Fluorescein Diacetate CAS:596-09-8 Purity:>98%
Medchemexpress, HY-D0719 5g Fluorescein Diacetate CAS:596-09-8 Fluorescein diacetate is a cell permeable esterase-substrate. Fluorescein diacetate can be used as a fluorogenic substrate for hGSTP1-1. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Biotium Thiol Reactive Dyes Reactive CF Dyes Other Dyes Biotinylation Reagents Reactive CF Dyes CF405 1/EA
CF Dye Maleimides are thiol-reactive fluorescent dyes Maleimides are commonly used to label proteins on free thiol groups CF dyes are Biotiums line of next-generation fluorescent dyes with advantages in brightness photostability and conjugate specificity compared to other fluorescent dyes Blue fluorescent CF405S dye has excitation/emission at 404/431 nm
Proteintech Group Inc Spot-Label Alexa Fluor 568
anti-Spot-Tag VHH/ Nanobody conjugated to fluorescent dye for immunofluorescence, microscopy, and immunoblotting of Spot-tagged proteins
HIMEDIA Bolton Selective Supplement, FD231, Microbiology Culture Media, Selective Supplement, Antibiotic Supplement, Campylobacter Enrichment, Lyophilized, Vials, 5 vials
Bolton Selective Supplement is a lyophilized antibiotic supplement for the selective enrichment of Campylobacter species from foods. Each vial, sufficient for 500 ml of medium, supplies cefoperazone, vancomycin, trimethoprim and amphotericin B, a combination that suppresses competing bacteria and fungi so injured Campylobacter can resuscitate and grow when added to Bolton Broth Base. Rehydrate with 50% aqueous ethanol before use. A key component of standard Campylobacter detection. Store at 2 to 8 C. Packaged as 5 vials.
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
CPC Scientific 5FAM-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: 5FAM-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C164H256N50O48S4MOLECULAR WEIGHT:3824.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)